Heat shock transcriptional factors in Malus domestica: identification, classification and expression analysis

  • Filomena Giorno1, 2Email author,

    Affiliated with

    • Gea Guerriero1,

      Affiliated with

      • Sanja Baric1 and

        Affiliated with

        • Celestina Mariani2

          Affiliated with

          BMC Genomics201213:639

          DOI: 10.1186/1471-2164-13-639

          Received: 13 June 2012

          Accepted: 8 November 2012

          Published: 20 November 2012

          Abstract

          Background

          Heat shock transcriptional factors (Hsfs) play a crucial role in plant responses to biotic and abiotic stress conditions and in plant growth and development. Apple (Malus domestica Borkh) is an economically important fruit tree whose genome has been fully sequenced. So far, no detailed characterization of the Hsf gene family is available for this crop plant.

          Results

          A genome-wide analysis was carried out in Malus domestica to identify heat shock transcriptional factor (Hsf) genes, named MdHsfs. Twenty five MdHsfs were identified and classified in three main groups (class A, B and C) according to the structural characteristics and to the phylogenetic comparison with Arabidopsis thaliana and Populus trichocarpa. Chromosomal duplications were analyzed and segmental duplications were shown to have occurred more frequently in the expansion of Hsf genes in the apple genome. Furthermore, MdHsfs transcripts were detected in several apple organs, and expression changes were observed by quantitative real-time PCR (qRT-PCR) analysis in developing flowers and fruits as well as in leaves, harvested from trees grown in the field and exposed to the naturally increased temperatures.

          Conclusions

          The apple genome comprises 25 full length Hsf genes. The data obtained from this investigation contribute to a better understanding of the complexity of the Hsf gene family in apple, and provide the basis for further studies to dissect Hsf function during development as well as in response to environmental stimuli.

          Keywords

          Hsf Malus domestica Gene expression High temperature Apple fruit/ flower

          Background

          Trees are sessile organisms with long lifespans that regularly experience climatic fluctuations in their native environment. Therefore, survival and reproduction is dependent upon an array of protective mechanisms that involve the activation of a wide range of transcriptional factors, and their products are considered to play a central role in response to extreme physiological conditions. There is evidence that members of the heat shock transcriptional factor (Hsf) family are important regulators in sensing and signaling of different environmental stresses [1]. Similarly to many other transcription factors, the Hsfs have a modular structure containing signature domains structurally and functionally conserved throughout the eukaryotic kingdom. A common core structure in the Hsfs is composed of an N-terminal DNA binding domain (DBD), characterized by a central helix-turn-helix motif that specifically binds to the heat shock elements (HSE) in the target promoters, and an adjacent bipartite oligomerization domain (HR-A/B) composed of hydrophobic heptad repeats [2]. Hsf trimerization via the formation of a triple stranded alpha-helical coiled-coil is a prerequisite for high affinity DNA binding and, subsequently, for transcriptional activity. Other Hsf functional modules include clusters of basic amino acids essential for nuclear import (NLS), leucine-rich export sequences important for nuclear export (NES), and a less conserved C-terminal activator domain (CTAD) rich in aromatic, hydrophobic and acidic amino acids, the so-called AHA motifs [2, 3].

          In contrast to Saccharomyces cerevisiae, Caenorhabditis elegans, and Drosophila melanogaster, that each possesses only a single Hsf gene, plant genomes contain large numbers of Hsf genes, up to 52 [1, 4, 5]. Based on structural characteristics and phylogenetic comparisons, plant Hsfs are grouped into classes A, B and C [2, 6]. All class A and C Hsfs have an extended HR-A/B region due to the insertion of 21 (Class A) or seven (class C) amino acid residues between A and B parts of the HR-A/B region. On the contrary, in class B Hsfs, the HR-A/B region does not contain insertions. In addition, sequence comparisons and structural analyses indicate that the combination of a AHA motif with an adjacent nuclear export signal NES represents a peculiar signature domain for many plant class A Hsfs [6, 7].

          After the release of the whole genomic sequences of several plant organisms, including rice (Oryza sativa), maize (Zea mays), poplar (Populus trichocarpa), medicago (Medicago truncatula), tomato (Solanum lycopersicon), the Hsfs family was analyzed extensively, both to place each member in an organized nomenclature system and to provide maps of their expression [710].

          Recently, the full genome sequence of the domesticated apple (Malus domestica Borkh) has been published [11]. This provides a useful genomic tool to study this economically important fruit crop. As transcriptional factors, Hsfs are involved in different aspects of plant life including tolerance to biotic/abiotic stresses and developmental processes [1214]. Therefore, this gene family represents an important group of transcriptional factors to investigate and to characterize. Genome scale analyses of the transcriptional response during development and to environmental stimuli require a precise and complete annotation of genes in order to provide reliable and exhaustive data. Therefore, the aim of this study was to annotate the full length Hsf genes in apple, and to analyze their expression profiles by quantitative real time PCR (qRT-PCR) in different organs/tissues from plants grown in the field and exposed to natural environmental conditions. The results of this work provide a foundation to better understand the functional structure and genomic organization of the Hsf gene family in apple, and will be undoubtedly useful in future gene cloning and functional studies.

          Results

          Identification, classification and duplication of Hsf genes in the Malus domestica genome

          CDS sequences corresponding to putative Hsf genes from Malus domestica (MdHsfs) were searched in the Apple Genome v1.0 [15]. As a result, 36 genes encoding for putative MdHsfs proteins were identified. All candidate MdHsf proteins were surveyed, and incomplete sequences for the DBD domain and for the remaining functional domains were removed. This resulted in the selection of twenty five complete sequences. These MdHsf genes were distributed on 12 of the 17 apple chromosomes with the largest number, comprised of six Hsf genes, detected on chromosome 15 (Table 1). According to the multiple sequence alignment of the DBD and HR-A/B region, 16 genes were determined to be Class A, seven genes were identified as Class B and two were classified as Class C.
          Table 1

          List of Hsfs genes in the Malus domestica genome

          Gene name

          Chromosomal localization

          Size (aa)

          MW(kDa)

          pI

          MdHsfA1a

          Chr6

          MDP0000517644

          540

          59.37

          4.76

          MdHsfA1b

          Chr10

          MDP0000156337

          546

          61.14

          4.96

          MdHsfA1c

          Chr13

          MDP0000232623

          550

          60.07

          6.01

          MdHsfA1d

          Chr16

          MDP0000259645

          580

          64.34

          5.04

          MdHsfA2a

          Chr8

          MDP0000489886

          380

          42.42

          4.73

          MdHsfA2b

          Chr15

          MDP0000243895

          377

          42.24

          4.63

          MdHsfA3a

          Chr12

          MDP0000131346

          516

          56.26

          4.18

          MdHsfA3b

          Chr14

          MDP0000606400

          455

          50.37

          6.43

          MdHsfA3c

          Chr14

          MDP0000174161

          582

          64.34

          4.89

          MdHsfA4a

          Chr5

          MDP0000155849

          420

          47.23

          5.62

          MdHsfA5a

          Chr9

          MDP0000301101

          483

          53.81

          5.08

          MdHsfA5b

          Chr15

          MDP0000613011

          482

          54.19

          5.48

          MdHsfA8a

          Chr10

          MDP0000191541

          414

          46.89

          4.55

          MdHsfA8b

          Chr13

          MDP0000172376

          411

          44.86

          5.10

          MdHsfA9a

          Chr2

          MDP0000194672

          713

          75.89

          6.86

          MdHsfA9b

          Chr15

          MDP0000319456

          482

          53.29

          4.86

          MdHsfB1a

          Chr2

          MDP0000527802

          294

          32.26

          8.76

          MdHsfB1b

          Chr15

          MDP0000578396

          232

          28.40

          4.67

          MdHsfB2a

          Chr1

          MDP0000155667

          276

          30.97

          5.96

          MdHsfB3a

          Chr12

          MDP0000622590

          243

          27.77

          7.22

          MdHsfB3b

          Chr14

          MDP0000202716

          243

          27.82

          7.82

          MdHsfB4a

          Chr8

          MDP0000209135

          381

          42.85

          7.62

          MdHsfB4b

          Chr15

          MDP0000129357

          383

          43.19

          7.64

          MdHsfC1a

          Chr2

          MDP0000230456

          324

          36.25

          6.27

          MdHsfC1b

          Chr15

          MDP0000320827

          344

          38.36

          5.02

          MW: molecular weight; pI: Isoelectric point.

          Gene duplication events have been indicated as an important mechanism in the evolution of plant genomes [16]. Therefore, duplications of MdHsfs were also analyzed. As shown in Figure 1, a total of 12 duplicated gene pairs of MdHsfs were identified, including 11 segmental duplication events between chromosomes (e.g. MdHsfC1a and MdHsfC1b) as well as one tandem duplication event within the same chromosome, e.g. MdHsfA3c and MdHsfA3b. MdHsfA3c was the only Hsf involved in both duplication events, as it was duplicated with MdHsfA3b in tandem on chromosome 14 and also segmentally duplicated with MdHsfA3a on chromosome 12.
          http://static-content.springer.com/image/art%3A10.1186%2F1471-2164-13-639/MediaObjects/12864_2012_4743_Fig1_HTML.jpg
          Figure 1

          Localization and duplication of the Hsf genes in the apple genome. Circular visualization of the 25 Hsfs mapped on the different chromosomes in the apple genome was obtained using the Circos software. Picture shows only the chromosomes containing MdHsf genes, and chromosome number is indicated on the inner side. Segmental duplications were joined by the lines, while the tandem duplication of MdHsfA3b and MdHsfA3c is indicated by an asterisk.

          Analysis of conserved domains in the apple Hsf proteins

          Prediction of the typical signature domains present in the MdHsfs protein sequences was carried out by comparing the identified apple Hsfs to those of homologous, well characterized proteins of model plants such as tomato or Arabidopsis [2, 6, 7]. Table 2 lists five conserved motifs that were identified by sequence alignment, and their positions in the protein sequences. All the MdHsfs showed the presence of the highly conserved DBD domain in the N-terminal region, consisting of a three-helical bundle (H1, H2 and H3) and a four-stranded antiparallel β-sheet. The length of the DBD motif was quite variable with the smaller size observed for MdHsfB1b. The presence of the coiled-coil structure characteristic of leucine-zipper type protein interaction domains, which is a property of the HR-A/B region, was instead predicted in all MdHsfs proteins by using MARCOIL tool. Furthermore, the majority of the MdHsfs showed the presence of NES and NLS domains which were described to be essential for shuttling Hsfs between nucleus and cytoplasm [7]. Additional sequence comparison allowed the identification of AHA motifs in the center of the C-terminal activation domains, as it is expected in the A-type Hsfs. By contrast, these domains were not identified in the B and C-type MdHsfs.
          Table 2

          Functional motifs of apple Hsfs

          Gene name

          DBD

          HR-A/B

          NLS

          NES

          AHA

          MdHsfA1a

          39-132

          154-220

          (242) NKKRRLKK

          (502) MDNLTEKMG

          AHA (454) DIEAFLKDWDD

          MdHsfA1b

          17-152

          174-240

          (264) NKKRRLPR

          (529) MNHITEQM

          AHA (482) DIFWEQFLTAS

          MdHsfA1c

          16-156

          173-243

          (268) NKKRRLPR

          (533) MNHITEQMQ

          AHA (486) DIFWEQFLTAS

          MdHsfA1d

          103-196

          217-284

          (307) NKKRRLKR

          (563) MDNLTEKMG

          AHA (516) DIEAFLKDWDD

          MdHsfA2a

          30-132

          147-213

          (228) KNRK-X7-RKRR

          (368) LLDQMGYQ

          AHA1 (318) ETIWEELWSD AHA2 (360) DWGKDLQD

          MdHsfA2b

          38-131

          145-212

          (227) KNR-X6-RKRR

          (365) LVDQMGYL

          AHA1 (315) ETIWEELWSD AHA2 (355) DWGEDLQD

          MdHsfA3a

          99-209

          226-285

          (297) KTRRKFVK

          nd

          AHA1 (431) EDIWSMGFGV AHA2 (450) ELWGNPVNY AHA3(470) LDVWDIGPLQ AHA4 (486) IDKWPAHDS

          MdHsfA3b

          99-232

          253-312

          (328) KDIGSSRVRRKFVK

          nd

          nd

          MdHsfA3c

          99-244

          265-324

          (340) KDIGSSRVRRKFVK

          nd

          AHA1 (500) EDIWSMNFDV AHA2 (518) NELWGNPXNY AHA3 (539) LDVWDIDPLQ AHA4 (555) INKWPAHES

          MdHsfA4a

          10-103

          123-190

          (208) RKRRLPR

          (407) LTEQMGHL

          AHA1 (252) LTFWEDTIHD AHA2 (356) DGFWEQFLTE

          MdHsfA5a

          12-105

          116-183

          (194) RK-X10-KKRR

          (477) AETLTL

          AHA (431) DVFWEQFLTE

          MdHsfA5b

          12-105

          117-183

          (194) RK-X10-KKRR

          (477) AETLTL

          AHA (431) DVFWEQFLTE

          MdHsfA8a

          18-111

          129-199

          (177) RNRLR

          (389) TEQMGHL

          AHA (308) DGAWEQFLLA

          MdHsfA8b

          18-111

          127-196

          (172) RLLRNR

          nd

          AHA (306) DGAWEQLLLG

          MdHsfA9b

          139-239

          241-308

          (324) KR-X8-KRRR

          (258) LKADQD

          nd

          MdHsfA9b

          139-239

          241-308

          (324) KR-X8-KRRR

          (258) LKADQD

          nd

          MdHsfB1a

          6-99

          142-191

          (246) KGDEKMKGKK

          nd

          nd

          MdHsfB1b

          2-35

          78-127

          (181) KGEEKMKGKK

          (159) LDMEGG

          nd

          MdHsfB2a

          22-115

          154-197

          (167) RLRK

          nd

          nd

          MdHsfB3a

          19-112

          149-194

          (223) RKRKR

          (208) PKLFGVRLE

          nd

          MdHsfB3b

          22-116

          149-194

          (179) KRKCK (223) RKRKR

          (208) LKLFGVRLE

          nd

          MdHsfB4a

          21-114

          183-239

          (325) KNTK-X9-KKR

          (366) LEKDDLGLQLM

          nd

          MdHsfB4b

          21-114

          180-240

          (327) KNTK-X9-KKR

          (368) LEKDDLGLHLM

          nd

          MdHsfC1a

          7-100

          119-171

          (195) KKRR

          nd

          nd

          MdHsfC1b

          9-102

          128-180

          ( 204) KKRR

          nd

          nd

          Number in brackets indicates the position of the first amino acid present in the putative nuclear localization signal (NLS), nuclear export signal (NES) and activator (AHA) motifs in the C-terminal domains. nd, no motifs detectable by sequence similarity searches.

          A second approach was used to identify and to verify domain prediction in the MdHsf proteins, by using the MEME motif search tool. Thirty corresponding consensus motifs were detected (Figure 2; Table 3). The majority of MdHsfs displayed the presence of the motifs 1, 2, 3, 4, 5 which correspond to highly conserved regions including the DBD and HR-A/B region domains. In addition, the inspection of motif distribution revealed that some of them were only present in specific classes of the MdHsf family. For example, motif 10 was representative of A-type Hsf members such as MdHsfA1a-A1d, MdHsfA4a, MdHsfA8a, and it contained the signature domains corresponding to NES sequence. Similarly, motif 7 containing the AHA sequence was detected in the C-terminal parts of many MdHsf proteins, belonging to the A class. Furthermore, eight A-type Hsfs members, namely MdHsfA1a-A1d, MdHsfA2a-b, MdHsfA5a-b were characterized by the presence of motif 13 which contained the NLS domains. Interestingly, all B Hsfs members exhibited motif 20, while MdHsfC1a and MdHsfC1b contained the motif 29 (Table 3).
          http://static-content.springer.com/image/art%3A10.1186%2F1471-2164-13-639/MediaObjects/12864_2012_4743_Fig2_HTML.jpg
          Figure 2

          Motifs identified by MEME tools in apple Hsfs. Thirty motifs were identified and indicated by increasing number from 1 to 30. Their distribution and visualization on the full length protein sequences was performed by using the Expasy mydomain tools.

          Table 3

          Motif sequences identified by MEME tools in apple Hsfs

          Motif

          Length

          Best possible match

          1

          50

          TDHIISWSDANNSFVVWDPPEFARDLLPKYFKHNNFSSFIRQLNTYGFRK

          2

          29

          VDPDRWEFANEWFQRGQKHLLCNIHRRKH

          3

          50

          LMQEIVRLRQQQQYTQNQLHAMNQRLQGMECRQQQMMSFLAKAMHNPGFL

          4

          21

          LHKTGPPPFLCKTYDMVDDPA

          5

          29

          YQQNPTGACVEVGKCGLWDEIERLKRDKN

          6

          26

          CHKYMDGQIVKYQPPMNEAAKAMLRP

          7

          29

          TPYTHPDIVNDIFWEQFWTARPICGNIEE

          8

          50

          FEQSPHYPSQVTTGKLGLDAESTAFQFVDAALDELAITQGFLETPEQEGE

          9

          28

          MLMSELAHMKKKCNEIIYFVANYVCMAW

          10

          20

          GWDKSQNMNHITEQMGHLTS

          11

          41

          QTDVVIPELTRIQGIVPEGNVDIPNANMIGEDIGNGFYMGM

          12

          41

          EFEAFCSVNPLGAFDFTEKVSIPTSSMGGGGAEDVVVPPQP

          13

          20

          HVHKNEKNRRITGYNKKRRL

          14

          49

          IINPDAMLITKAPTGATNTRNSSQPGYGYTNGGGGHISCEVNYPTESTP

          15

          50

          MSPKDESHPKSPPTSAEFDPESIGLSEFRPQVSAPLLGSQPIPSFTSPVM

          16

          50

          PSNSYPSSMLLCNPQPPKHNGPNGNLNQLQGYYPAAPPPNAKQNPHHIMN

          17

          49

          MIKQEDIWSMGFGVSAGMSTSMHELWGNPVNYDVPEMGVTGGLLDVWDI

          18

          26

          AQPHQVGLNHHHHHHSPLGMNGHHHH

          19

          50

          DGFIDPTSEVMNGSLPIDFDDISSDIEAFLKDWDDIIQNPGADEMDSTCA

          20

          14

          EEECKNLKLFGVWL

          21

          15

          VRRKFVKHQQHELSK

          22

          45

          QQLMQKRMIKRELDGGDLGKRRRLPPAQGIESFDEWINDSLSFDC

          23

          50

          FHQDFSSKLRLELSPAVSDMNLVSRSTQSSNEDGGSSTRKISEELKGAQM

          24

          50

          GASSMVTEDPFFKGKSVLSPQQEANPERYVSFQEDLVKDRTFPELFSPGM

          25

          41

          NSGSEKQPEVDAYMDGMEDFVVNPDFMKMLMDEKLSPVENH

          26

          41

          FFPFPSRGSISPSDSDEQPNWCDSDSPPLLSPTGGINTNIN

          27

          40

          PRMIQEIDYSAAAELGEKAKMVMMIAFTSSTAADDDKTTT

          28

          11

          THVHDHQQQPP

          29

          41

          ISSSPEAGFEMESFNRYPTPPEVQTASDWLRQRWFVDRVRA

          30

          50

          CVSGVTLQEVPLTSGHGLPSVISETHSPPRVANPGTVMRSPFSDVNALVG

          Numbers in the first column indicate the motifs represented in the Figure 2.

          Phylogenetic analysis of apple Hsf proteins

          To investigate the evolution of Hsfs an unrooted phylogenetic tree was generated by using the 25 Malus domestica Hsfs, 28 Populus trichocarpa Hsfs (PtHsfs) and 21 Arabidopsis thaliana Hsfs (AtHsfs). Populus and Arabidopsis were chosen because their full sequence genome has been released, and Hsf members have been well characterized [7, 10]. Moreover, the former is a tree. Figure 3 shows the result of this analysis. Hsfs of Malus domestica, Arabidopsis thaliana and Populus trichocarpa were clearly grouped into three different clades corresponding to the main Hsf classes A, B and C. Within the A-type clade, nine distinct sub-clades were resolved, seven of which (A1, A2, A3, A4, A5, A8 and A9) comprised the apple Hsf sequences. The C-type Hsfs from the three plant species also constituted one distinct clade which appeared more closely related to the Hsf A-group. Correspondingly, the B-type Hsfs from the three plant species grouped in a separate clade. Two of the five sub-clades, B3 and B2, were paraphyletic. As expected, the duplicated Hsfs of Malus domestica clustered all together on the phylogenetic tree.
          http://static-content.springer.com/image/art%3A10.1186%2F1471-2164-13-639/MediaObjects/12864_2012_4743_Fig3_HTML.jpg
          Figure 3

          Neighbor-joining phylogeny of Hsfs from M. domestica, P. trichocarpa and A. thaliana. The phylogenetic tree was obtained using the MEGA 5.0 software on the basis of amino-acid sequences of the N-terminal domains of MdHsfs including the DNA-binding domain, the HR-A/B region and the linker between both regions. The final dataset included a total of 281 positions. Evolutionary distances were computed using the Jones-Taylor-Thornton matrix-based method and by removing all ambiguous positions for each sequence pair. Numbers indicate bootstrap values >80 based on 1000 replicates for the major nodes. The abbreviations of species names are as follows: Md, Malus domestica; Pt, Populus trichocarpa; At, Arabidopsis thaliana.

          In silico expression analyses of MdHsf genes

          Tissue specific expression of MdHsfs was investigated by counting the number of ESTs per tissue from EST libraries [17]. This resulted in the assignment of MdHsfs to nine groups on the basis of the tissue and organ types in which MdHsfs were present (Table 4).
          Table 4

          Digital expression of MdoHsf genes

          Tissue and organ type (DFCI Apple Gene Index)

          Gene name

          Leaf

          Root

          Flower

          Fruit

          Shoot

          Phloem

          Xylem

          Seed

          Bud

          MdHsfA1a

          +

           

          +

          +

          +

          +

             

          MdHsfA1b

             

          +

               

          MdHsfA1c

             

          +

               

          MdHsfA1d

          +

           

          +

          +

          +

          +

             

          MdHsfA2a

           

          +

          +

           

          +

              

          MdHsfA2b

           

          +

                 

          MdHsfA3a

              

          +

              

          MdHsfA3b

              

          +

              

          MdHsfA3c

              

          +

              

          MdHsfA4a

           

          +

          +

                

          MdHsfA5a

           

          +

          +

          +

               

          MdHsfA5b

           

          +

          +

          +

               

          MdHsfA8a

             

          +

               

          MdHsfA8b

             

          +

               

          MdHsfA9a

          +

                  

          MdHsfA9b

                 

          +

           

          MdHsfB1a

          +

          +

           

          +

           

          +

          +

            

          MdHsfB1b

          +

          +

           

          +

           

          +

          +

            

          MdHsfB2a

               

          +

             

          MdHsfB3a

            

          +

                

          MdHsfB3b

            

          +

                

          MdHsfB4a

                  

          +

          MdHsfB4b

                  

          +

          MdHsfC1a

           

          +

                 

          MdHsfC1b

           

          +

                 

          +: Expressed; blank: not expressed.

          Of the group A1, MdHsfA1a and MdHsfA1d, were the most represented as their expression was detected in leaf, flower, fruit, shoot and phloem. Similarly, MdHsfB1a and MdHsfB1b of B class were expressed in several apple tissues. Interestingly, MdHsfA9b was the only Hsf specific for seed, whereas MdHsfA9a was found in leaf. Furthermore, expression restricted to only a single tissue type was observed also for other members of the MdHsf family; all A3-type MdHsfs were expressed in shoot and both members of the class C were found in root. In addition, the analysis of digital data showed that duplicated genes located on different chromosomes had identical expression patterns (e.g. MdHsfB4a and MdHsfB4b, MdHsfC1a and MdHsfC1b).

          Expression analysis of MdHsf genes in apple organs under natural environmental conditions

          Hsf genes are differentially expressed during flower and fruit development and are induced by abiotic environmental factors [7, 12, 13]. To investigate if MdHsfs are also involved in these processes, a comprehensive analysis of their expression was performed in flowers and fruits from field-grown trees. Flowers were harvested at the stages of tight cluster, full pink and anthesis (FLS1, FLS2, FLS3) during spring at average temperatures of 23°C/7°C (day/night; max/min), while the developing fruits were chosen at the stage of 10, 15 and 20 mm in diameter (FUS1, FUS2, FUS3) and harvest at average temperatures of 23°C/14°C (day/ night; max/min). Quantitative real-time PCR was used as the approach to monitor gene expression changes, and MdHsf transcript abundance in developing flowers/fruits was compared to that of vegetative leaf tissue (3–5 cm in length). The transcriptional patterns could be analyzed only for 20 MdHsf genes, since it was not possible to design specific primers discriminating MdHsfA5a-b, MdHsfA8a-b, MdHsfB3a-b, MdHsfB4a-b and MdHsfC1a-b because of high sequence similarity with the corresponding isoform. Figure 4 shows the results of this analysis. Members of A1 subgroups such as MdHsfA1a-d exhibited transcript accumulation in all tissues analyzed, although a higher induction was observed in flowers especially at anthesis. Similar to the A1-subgroup, higher messenger RNA levels at anthesis were also observed for other members of A class such as MdHsfA2a-b, MdHsfA3b-c, MdHsfA5a-b and MdHsfA9a. Interestingly, MdHsfA9b was approximately 4-fold more strongly induced in the youngest flowers than at the later stages. A broad variability of expression patterns in flowers and fruits was instead observed for the MdHsf members belonging to the B class. MdHsfB1a displayed a similar trend as a large part of the A members with higher expression at anthesis. On the contrary, its duplicated gene MdHsfB1b did not show any remarkable transcript changes between the different flower and fruit stages. MdHsfB2a showed strong up-regulation in 20 mm fruit where it was 30-fold higher than in leaf tissue. The B4-type gene MdHsfB4a-b exhibited a lower expression in flower/fruit than in leaf. Low transcript abundances in fruit as compared to flower or leaf were also observed for MdHsfC1a-b.
          http://static-content.springer.com/image/art%3A10.1186%2F1471-2164-13-639/MediaObjects/12864_2012_4743_Fig4_HTML.jpg
          Figure 4

          Expression analyses of MdHsfs in developing flowers and fruits. Quantification of messenger RNA levels was performed in developing flowers corresponding to the tight cluster, full pink and full bloom stages (FLS1, FLS2, FLS3) and in developing fruits of 10, 15 and 20 mm in diameter (FUS1, FUS2, FUS3). The relative expression of MdHsf genes in flower/fruit/different stages was calculated in relation to young leaves of 3–5 cm in length. The qRT-PCR analysis results were normalized using EF1, Tip-41 and IMPA9 as housekeeping genes. Each bar represents the average of the relative expression levels from three biological replicates.

          To further characterize the expression of Hsf family genes in apple, the quantitative real-time PCR analysis was extended to leaf samples harvested from field-grown trees exposed to naturally increased temperatures. Leaf samples were taken during the summer period, at two different temperature ranges: at 26°C/12°C (day/night; max/min) on 30th July 2011, which were used as reference, and at high temperature average of 32°C/17°C (day/night; max/min) on the 21st August 2011 (Additional file 1: Figure S1).

          The transcriptional analyses revealed that in leaf most of the MdHsfs genes were responsive to the increased temperatures (Figure 5). Twelve of these responsive genes showed transcript accumulation significantly higher than the reference sample, while only MdHsfA9b and MdHsfB4a-b were strongly down-regulated in response to the increased temperatures. A 4-fold or higher increase of expression levels in response to high temperatures was observed for MdHsfA2a-b, MdHsfA3b-c, MdHsfB1a, MdHsfB2a, MdHsfB3a-b and MdHsfC1a-b, and only slightly higher in the stressed leaves than in the reference onces for MdHsfA4a, MdHsfA5a-b and MdHsfA8a-b. Furthermore, all subgroup A1 members such as MdHsfA1a-d did not show any significant transcriptional changes in response to the high temperatures compared to the reference conditions.
          http://static-content.springer.com/image/art%3A10.1186%2F1471-2164-13-639/MediaObjects/12864_2012_4743_Fig5_HTML.jpg
          Figure 5

          Expression analyses of MdHsfs in vegetative leaf tissue under heat stress. Messenger RNA levels of MdHsfs were analyzed by qRT-PCR in leaf samples from trees grown under field conditions and exposed to different temperature ranges: reference temperature, average of 26°C/12°C (day/night; max/min), considered as normal conditions; and high temperature, average of 32°C/17°C (day/night; max/min), considered as stress conditions. The qRT-PCR analysis results were normalized using EF1, Tip-41 and IMPA9 as housekeeping genes. Each bar represents the average of the relative expression levels from three biological replicates.

          Discussion

          In plants, members of the Hsf family have been described as key regulators in molecular and cellular responses to stress conditions [1, 7]. Furthermore, data from tomato and Arabidopsis have shown that the Hsfs are important components involved in developmental signalling [13, 14]. Both size and composition of the Hsf family have been analyzed and characterized in different plant species [1]. The present study investigates for the first time this gene family in the economically relevant domesticated apple and shows that its genome contains 25 full length Hsf genes. This number is similar to that of Populus trichocarpa for which 28 loci encoding Hsf proteins were found [10]. Velasco et al. [2010] have shown that genome wide duplications had occurred in apple causing the expansion of several gene classes. Indeed, it was found that the enlargement of the MdHsf family is in particular originated from segmental duplications between different chromosomes. This situation is similar in maize and in Populus, in which segmental Hsf gene duplications were more prevalent than those of tandem duplications [9, 10]. Gene duplications have an important role not only in the genomic rearrangement and expansion but also in diversification of gene function. In particular, genes encoding for nucleic acid binding proteins, among which transcription factors, originated mostly by segmental duplication. In contrast, membrane proteins and proteins involved in the stress response are encoded by genes mainly duplicated in tandem [18, 19]. Therefore, the prevalence of segmental duplication events in MdHsf expansion may be associated to the fact that these genes act as transcriptional regulators.

          Malus, Arabidopsis and Populus belong to the Rosid lineage and they are grouped in two distinct clades, namely Fabids (Malus and Populus) and Malvids (Arabidopsis) [20]. It was observed in the present study that the majority of the MdHsfs had a closer phylogenetic relationship to the PtHsfs than to the AtHsfs. This may be attributable to the fact that Malus and Populus belong to the same Fabids clade, and as they are both trees may have adapted to prolonged and repeated environmental constraints, unlike Arabidopsis.

          Functional diversification of multifamily duplicated genes has been observed in trees. For example, the family of the glutathione S-transferase in Populus has a clear divergence in expression patterns in response to different stress treatments [21]. Therefore the presence of many duplicated Hsf genes in the apple genome may be related to the fact that a sub-functionalization has taken place especially to cope with prolonged and specific stress conditions.

          MdHsf genes were found to be expressed in several apple tissues. In particular, members belonging to the A1 and B1 subclasses, such as MdHsfA1a, MdHsfA1d, MdHsfB1a, MdHsfB1b, were constitutively expressed in different tissues. A similar situation was found in other plants like Arabidopsis where A1-type Hsfs were involved in house-keeping processes under normal conditions, being ready for the fast activation of other Hsfs genes following stress treatment [22, 23]. Furthermore, expression data from flower and fruit tissues indicated that some duplicated gene pairs, e.g. MdHsfA9a and MdHsfA9b, exhibited differences in their expression levels. This suggests that they may be subjected to a different regulation in apple tissue [1, 7].

          In contrast, the expression of MdHsfA2a and MdHsfA2b was mainly detected in full bloom flowers. AtHsfA9 and LeHsfA2a (Le, Lycopersicon esculentum) were found expressed in seed and developing pollen grains [13, 14, 24]. It was shown that the presence of these Hsfs during plant development is important for heat shock protein activation. This suggests that MdHsfA2a and MdHsfA2b may be important during pollination and fertilization, which occurs at anthesis.

          Effects of heat stress (HS) on Hsf gene expression has been examined in several plant species, but no data are available about Hsf expression in trees exposed to naturally increased temperatures. Under laboratory settings, it was shown that AtHsfA1a and AtHsfA1b regulate the early response to HS in Arabidopsis [22, 25]. AtHsfA2 is rapidly induced by HS, and it is involved in enhancing and maintaining of HS-response when plants are exposed to prolonged or repeated cycles of HS [26, 27]. Similarly to AtHsfA2, AtHsfA3 is involved in thermo-tolerance mechanisms [7, 28, 29]. The A1-type MdHsfs were expressed at the same level also in leaves from plants growing in field and exposed to different temperature conditions. MdHsfA2a b, MdHsfA3b c were instead strongly induced. This may suggest that these types of MdHsfs could be involved in maintaining the stress response when apple trees are exposed to prolonged periods of high temperature conditions.

          In contrast to class A Hsfs, genes assigned to the B and C classes have so far not been fully characterized. Members of the B class were shown to act mainly as repressors of the expression of HS inducible genes [30, 31]. Some of them form a complex with Hsf A-types to maintain housekeeping gene expression during HS regimes [32]. Therefore, the strong transcriptional activation in apple may indicate that some of them may have a role in the response to the high temperatures also in this species. For the majority of MdHsfs, increased messenger RNA levels were observed under naturally increased temperatures. However, MdHsfA9b and MdHsfB4a-b were the only Hsf genes showing low transcript abundance. Although proteomic data are not available for all MdHsfs genes, their activation or repression may suggest that these transcripts could have a high hierarchy of molecular events induced by the high temperatures.

          Conclusions

          The complexity of the Hsf family has been object of many investigations in different plant species. Here, 25 full length Hsfs genes were identified in the apple genome. Based on structural characteristics of the proteins and on the comparison with homologues from other species, the 25 MdHsfs were grouped in three different classes. Segmental and tandem duplications were examined and contributed to the expansion of the Hsf family in the apple genome. The expression profiles in flowers/fruits at different developmental stages as well as in leaves exposed to naturally increased temperature indicated that MdHsfs may play a role in different aspects of apple growth/development.

          Malus domestica represents an economically important woody plant whose genome has been fully sequenced and whose commercial value is due to fruit production in the field. Therefore, understanding the role of protective genes as the Hsfs during development and under stress conditions is important. The results of this research will be undoubtedly useful for future gene cloning and functional studies and, in turn, for producing apple cultivars with improved genetic traits.

          Methods

          Identification and classification of Hsfs in Malus domestica

          The recently sequenced apple genome was investigated for putative genes encoding for MdHsfs (Md: Malus domestica) based on BLASTN and BLASTP in NCBI and TIGR-Apple databases [11, 15]. Physical localization of all candidate MdHsfs was analyzed in order to reject redundant sequences with the same chromosome location. In order to identify signature domains, the MdHsf sequences were compared to the Hsf proteins of Arabidopsis and tomato by amino acid sequence alignment using ClustalW (version 1.83). Presence of DBD domains and coiled-coil structures were checked by SMART and MARCOIL programs [33, 34]. In addition, identification of putative domain motifs in the full-length amino acid sequences of the MdHsfs was also performed by MEME tools [35]. Visualization of the Meme motifs in the MdHsfs was performed by using Expasy tools (http://​prosite.​expasy.​org/​mydomains). MdHsf names were assigned on the basis of the original nomenclature as worked out for the Arabidopsis thaliana Hsf family, and later applied to other plant Hsf families [2, 7]. Classification into three different groups A, B and C was based on the information of oligomerization domains [2].

          Phylogenetic analysis and gene duplication of MdHsfs

          Gene duplications in the apple genome were analyzed by testing the similarity of all MdHsf genes using ClustalW. A gene duplication was defined according to the following criteria: (1) the length of the sequence alignment covered ≥ 80 % of the longest gene, and (2) the similarity of the aligned gene regions was ≥ 80 % [36, 37]. Data were then plotted using Circos software [38].

          To understand the evolutionary relationships of the MdHsf proteins, a phylogenetic tree was constructed. The N-terminal Hsf protein sequences containing the DBD and HR-A/B regions from Malus domestica, Arabidopsis thaliana and Populus trichocarpa[7, 10] were aligned using ClustalW. A phylogenetic tree was constructed using the Neighbor Joining (NJ) method in MEGA (version 5.0) [39]. Based on the results of the model selection analysis, the Jones-Taylor-Thornton matrix-based method was used to compute evolutionary distances [40]. The rate variation among sites was modeled with a gamma distribution (shape parameter = 0.67). Bootstrap analysis was conducted with 1000 replicates to assess statistical support for each node.

          Digital and EST expression analysis

          The analysis of MdHsfs expression profiles was investigated at the transcriptional level. MdHsfs expression patterns were searched with the BLAST program in TIGR-Apple EST libraries [17] using the following parameters: maximum identity > 95%, length > 200 bp and E-value <10-10.

          Plant material

          Experiments were carried out in 2011 on 18-year-old apple trees (cultivar ‘Golden Delicious’ on M9 rootstock) trained with standard horticultural practices at the experimental farm of the Research Centre for Agriculture and Forestry Laimburg (South Tyrol, Italy). Samples were taken from 24 homogeneous trees grouped in 3 biological replicates each containing 8 trees distributed in the same block of the orchard. Tissue samples were collected between April and August 2011 from trees grown under field environmental conditions and exposed to natural variations of temperature and solar radiation. Temperature data are reported in the Additional file 1. Young leaves (3–5 cm in length) as well as developing flowers corresponding to the tight cluster (FLS1), pink (FLS2) and full bloom (anthesis, FLS3) stages were harvested from the plants during spring period and under max-minimum temperature average in the range of 23°C/7°C (day/night; max/ min). From the same trees developing fruits of 10 mm (FUS1), 15 mm (FUS2) and 20 mm (FUS3) in length were also collected under max-minimum temperatures of 23°C/14°C (day/night; max/min). For testing Hsfs gene expression under naturally increased temperature conditions, leaf samples were taken during the summer period, at two different temperature ranges: at 26°C/12°C (day/night; max/min) on 30th July, 2011, which were used as reference, and at high temperature average of 32°C/17°C (day/night; max/min) on the 21st August, 2011 (Additional file 1: Figure S1). All samples used in gene expression analyses were harvested at midday (12:00 am) and were positioned around 1.60 m in height from the soil.

          RNA isolation and quantitative real-time PCR (qRT-PCR) analyses

          Total RNA was isolated from apple tissues with the hot phenol method [41]. RNA quantity was measured using a NanoDrop ND-1000 spectrophotometer, and its quality was checked by agarose gel electrophoresis. For reverse transcription, total RNA was incubated with RNase-free DNase (RQ1; Promega, Madison, WI), and 1 μg was used for reverse transcription according to the manufacturer’s instructions (Superscript Vilo cDNA Synthesis kit; Invitrogen).

          The qRT-PCR analyses were carried out on a 7500 Fast Real-time PCR System (Applied Biosystems) with the ROX Reference Dye. Each reaction contained 12.5 μl SYBR GreenER qPCR SuperMix Universal (Invitrogen), 20 ng of cDNA and 400 nM of each specific primer. The qRT-PCRs were performed using a controlled temperature program starting with 10 min at 95°C, followed by 40 cycles of 15 s at 95°C and 60 s at 60°C. To verify the presence of a specific product, the melting temperature of the amplified products was determined. In addition, each PCR mixture was analyzed on a 2% agarose/ethidium bromide stained gel to verify the size of the amplified DNA fragment. The primers used for the qRT-PCRs were designed using Quantprime software and are reported in the Additional file 2[42]. The qRT-PCRs were performed in duplicated technical reactions and repeated on three independent biological replicates. Relative mRNA levels of the target genes were calculated based on Vandesompele et al. [2002] [43]. The genes encoding for elongation factor 1 alpha subunit (eF-1 alpha; accession number AJ223969.1), Importin alpha Isoform9 (IMPA-9; accession number CN909679) and Tip-41 like protein (Tip-41 CN941833) were used as references in the qRT-PCR analyses.

          Abbreviations

          Hsf: 

          Heat shock transcriptional factor

          HR-A/B: 

          Adjacent bipartite oligomerization domain

          AHA: 

          Activator motif

          CTAD: 

          C-terminal activation domain

          DBD: 

          DNA-binding domain

          HS: 

          Heat stress

          HSE: 

          Heat shock element

          NES: 

          Nuclear export signal

          NLS: 

          Nuclear localization signal

          qRT-PCR: 

          Quantitative reverse transcription real-time PCR.

          Declarations

          Acknowledgements

          The authors wish to thank Nunzio D’Agostino for suggestions during manuscript preparation and for his useful contribution in drawing the Circos Figure 1. Christine Kerschbamer is very thanked for the technical assistance, Philipp Brunner to assist with apple growth and Alberto Storti for his kind support during this research.

          The authors are grateful to the Foundation for Research and Innovation of the Autonomous Province of Bozen/Bolzano for covering the Open Access publication costs.

          This work was partially funded by the Autonomous Province of Bozen/Bolzano, Italy (Departments 31 and 33). The South Tyrolean Fruit Growers' Co-operatives, in particularly VOG and VIP, are acknowledged for co-financing the Strategic Project on Apple Proliferation – APPL.

          Authors’ Affiliations

          (1)
          Research Centre for Agriculture and Forestry Laimburg
          (2)
          Department of Molecular Plant Physiology, Radboud University Nijmegen

          References

          1. von Koskull-Döring P, Scharf KD, Nover L: The diversity of plant heat stress transcription factors. Trends Plant Sci 2007, 12:452–457.PubMedView Article
          2. Nover L, Bharti K, Döring P, Mishra SK, Ganguli A, Scharf KD: Arabidopsis and the heat stress transcription factor world: how many heat stress transcription factors do we need? Cell Stress Chaperone 2001, 6:177–189.View Article
          3. Döring P, Treuter E, Kistner C, Lyck R, Chen A, Nover L: The role of AHA motifs in the activator function of tomato heat stress transcription factors HsfA1a and HsfA2. Plant Cell 2000, 12:265–278.PubMed
          4. Morimoto RI: Regulation of the heat shock transcriptional response: crosstalk between a family of heat shock factors, molecular chaperones and negative regulators. Genes Dev 1998, 12:3788–3796.PubMedView Article
          5. Pirkkala L, Nykanen P, Sistonen L: Roles of the heat shock transcription factors in regulation of the heat shock response and beyond. FASEB J 2001, 15:1118–1131.PubMedView Article
          6. Baniwal SK, Bharti K, Chan KY, Fauth M, Ganguli A, Kotak S, Mishra SK, Nover L, Port M, Scharf KD, Tripp J, Weber C, Zielinski D, Döring P: Heat stress response in plants: a complex game with chaperones and more than twenty heat stress transcription factors. J Biosci 2004, 29:471–487.PubMedView Article
          7. Scharf KD, Berberich T, Ebersberger I, Nover L: The plant heat stress transcription factor (Hsf) family: Structure, function and evolution. Biochim Biophys Acta 2012,1819(2):104–119.PubMedView Article
          8. Chauhan H, Khurana N, Agarwal P, Khurana P: Heat shock factors in rice (Oryza sativa L.): genome-wide expression analysis during reproductive development and abiotic stress. Mol Genet Genomics 2011,286(2):171–187.PubMedView Article
          9. Lin YX, Jiang HY, Chu ZX, Tang XL, Zhu SW, Cheng BJ: Genome-wide identification, classification and analysis of heat shock transcription factor family in maize. BMC Genomics 2011, 12:76.PubMedView Article
          10. Wang F, Dong Q, Jiang H, Zhu S, Chen B, Xiang Y: Genome-wide analysis of the heat shock transcription factors in Populus trichocarpa and Medicago truncatula. Mol Biol Rep 2012,39(2):1877–1886.PubMedView Article
          11. Velasco R, Zharkikh A, Affourtit J, Dhingra A, Cestaro A, Kalyanaraman A, Fontana P, Bhatnagar SK, Troggio M, Pruss D, Salvi S, Pindo M, Baldi P, Castelletti S, Cavaiuolo M, Coppola G, Costa F, Cova V, Dal Ri A, Goremykin V, Komjanc M, Longhi S, Magnago P, Malacarne G, Malnoy M, Micheletti D, Moretto M, Perazzolli M, Si-Ammour A, Vezzulli S, et al.: The genome of the domesticated apple (Malus domestica Borkh). Nat Genet 2010,42(10):833–839.PubMedView Article
          12. Frank G, Pressman E, Ophir R, Althan L, Shaked R, Freedman M, Shen S, Firon N: Transcriptional profiling of maturing tomato (Solanum lycopersicum L.) microspores reveals the involvement of heat shock proteins, ROS scavengers, hormones, and sugars in the heat stress response. J Exp Bot 2009,60(13):3891–3908.PubMedView Article
          13. Giorno F, Wolters-Arts M, Grillo S, Scharf KD, Vriezen WH, Mariani C: Developmental and heat stress-regulated expression of HsfA2 and small heat shock proteins in tomato anthers. J Exp Bot 2010,61(2):453–462.PubMedView Article
          14. Kotak S, Vierling E, Bäumlein H, von Koskull-Döring P: A novel transcriptional cascade regulating expression of heat stress proteins during seed development of Arabidopsis. Plant Cell 2007, 19:182–195.PubMedView Article
          15. GDRhttp://​www.​rosaceae.​org/​projects/​apple_​genome
          16. Vision TJ, Brown DG, Tanksley SD: The origins of genomic duplications in Arabidopsis. Science 2000,290(5499):2114–2117.PubMedView Article
          17. TIGRhttp://​www.​tigr.​org/​
          18. Hanada K, Zou C, Lehti-Shiu MD, Shinozaki K, Shiu SH: Importance of lineage-specific expansion of plant tandem duplicates in the adaptive response to environmental stimuli. Plant Physiol 2008,148(2):993–1003.PubMedView Article
          19. Rizzon C, Ponger L, Gaut BS: Striking similarities in the genomic distribution of tandemly arrayed genes in Arabidopsis and rice. PLoS Comput Biol 2006, 2:e115.PubMedView Article
          20. Judd WS, Olmstead RG: A survey of tricolpate (eudicot) phylogenetic relationships. Am J Bot 2004,91(10):1627–1644.PubMedView Article
          21. Lan T, Yang ZL, Yang X, Liu YJ, Wang XR, Zeng QY: Extensive functional diversification of the Populus glutathione S-transferase supergene family. Plant Cell 2009,21(12):3749–3766.PubMedView Article
          22. Busch W, Wunderlich M, Schöffl F: Identification of novel heat shock factor-dependent genes and biochemical pathways in Arabidopsis thaliana. Plant J 2005,41(1):1–14.PubMedView Article
          23. Mishra SK, Tripp J, Winkelhaus S, Tschiersch B, Theres K, Nover L, Scharf KD: In the complex family of heat stress transcription factors, HsfA1 has a unique role as master regulator of thermotolerance in tomato. Genes Dev 2002,16(12):1555–1567.PubMedView Article
          24. Almoguera C, Rojas A, Díaz-Martín J, Prieto-Dapena P, Carranco R, Jordano J: A seed-specific heat-shock transcription factor involved in developmental regulation during embryogenesis in sunflower. J Biol Chem 2002,277(46):43866–43872.PubMedView Article
          25. Lohmann C, Eggers-Schumacher G, Wunderlich M, Schöffl F: Two different heat shock transcription factors regulate immediate early expression of stress genes in Arabidopsis. Mol Genet Genomics 2004,271(3):376.View Article
          26. Charng YY, Liu HC, Liu NY, Chi WT, Wang CN, Chang SH, Wang TT: A heat-inducible transcription factor, HsfA2, is required for extension of acquired thermotolerance in Arabidopsis. Plant Physiol 2007,143(1):251–262.PubMedView Article
          27. Meiri D, Breiman A: Arabidopsis ROF1 (FKBP62) modulates thermotolerance by interacting with HSP90.1 and affecting the accumulation of HsfA2-regulated sHSPs. Plant J 2009,59(3):387–399.PubMedView Article
          28. Schramm F, Larkindale J, Kiehlmann E, Ganguli A, Englich G, Vierling E, von Koskull-Döring P: A cascade of transcription factor DREB2A and heat stress transcription factor HsfA3 regulates the heat stress response of Arabidopsis. Plant J 2008,53(2):264–274.PubMedView Article
          29. Chen H, Hwang JE, Lim CJ, Kim DY, Lee SY, Lim CO: Arabidopsis DREB2C functions as a transcriptional activator of HsfA3 during the heat stress response. Biochem Biophys Res Commun 2010,401(2):238–244.PubMedView Article
          30. Czarnecka-Verner E, Yuan CX, Scharf KD, Englich G, Gurley WB: Plants contain a novel multi-member class of heat shock factors without transcriptional activator potential. Plant Mol Biol 2000, 43:459–471.PubMedView Article
          31. Ikeda M, Mitsuda N, Ohme-Takagi M: Arabidopsis HsfB1 and HsfB2b act as repressors of the expression of heat-inducible Hsfs but positively regulate the acquired thermotolerance. Plant Physiol 2011,157(3):1243–1254.PubMedView Article
          32. Bharti K, Von Koskull-Döring P, Bharti S, Kumar P, Tintschl-Körbitzer A, Treuter E, Nover L: Tomato heat stress transcription factor HsfB1 represents a novel type of general transcription coactivator with a histone-like motif interacting with the plant CREB binding protein ortholog HAC1. Plant Cell 2004,16(6):1521–1535.PubMedView Article
          33. SMARThttp://​smart.​embl/​heidelberg.​de/​
          34. MARCOILhttp://​toolkit.​tuebingen.​mpg.​de/​marcoil
          35. Bailey TL, Williams N, Misleh C, Li WW: MEME: discovering and analyzing DNA and protein sequence motifs. Nucleic Acids Res 2006, 34:W369-W373.PubMedView Article
          36. Yang S, Zhang X, Yue JX, Tian D, Chen JQ: Recent duplications dominate NBS-encoding gene expansion in two woody species. Mol Genet Genomics 2008, 280:187–198.PubMedView Article
          37. Gu Z, Cavalcanti A, Chen FC, Bouman P, Li WH: Extent of gene duplication in the genomes of Drosophila, nematode, and yeast. Mol Biol Evol 2002, 19:256–262.PubMedView Article
          38. Krzywinski M, Schein J, Birol I, Connors J, Gascoyne R, Horsman D, Jones SJ, Marra MA: Circos: an information aesthetic for comparative genomics. Genome Res 2009, 19:1639–1645.PubMedView Article
          39. Tamura K, Dudley J, Nei M, Kumar S: MEGA4: Molecular Evolutionary Genetics Analysis (MEGA) software version 4.0. Mol Biol Evol 2007, 24:1596–1599.PubMedView Article
          40. Jones DT, Taylor WR, Thornton JM: The rapid generation of mutation data matrices from protein sequences. Comput Appl Biosci 1992, 8:275–282.PubMed
          41. Gambino G, Perrone I, Gribaudo I: A Rapid and effective method for RNA extraction from different tissues of grapevine and other woody plants. Phytochem Anal 2008,19(6):520–525.PubMedView Article
          42. Arvidsson S, Kwasniewski M, Riaño-Pachón DM, Mueller-Roeber B: QuantPrime–a flexible tool for reliable high-throughput primer design for quantitative PCR. BMC Bioinforma 2008, 9:465.View Article
          43. Vandesompele J, De Preter K, Pattyn F, Poppe B, Van Roy N, De Paepe A, Speleman F: Accurate normalization of real-time quantitative RT-PCR data by geometric averaging of multiple internal control genes. Genome Biology 2002,3(7):1–11. 3 RESEARCH0034View Article

          Copyright

          © Giorno et al.; licensee BioMed Central Ltd. 2012

          This article is published under license to BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://​creativecommons.​org/​licenses/​by/​2.​0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.

          Advertisement