Skip to main content

Table 3 Motif sequences identified by MEME tools

From: Genome-wide identification, classification and analysis of heat shock transcription factor family in maize

Motif Multilevel consensus sequence
1 PKYFKHNNFSSFVRQLNTYGFRKIDPDRWEFANECFLRGQKHLLKNIHRRKP
2 NVLMQEVVKLRQQQQTTKWQMQAMEQRLQHMEQRQQQMMSFLAKVMQNP
3 PFLTKTYDMVDDPATDHVISWNEDN
4 SFVRQLNTYGFRKVDPDRWEFANECFLRGQKHLLCNIHRRK
5 SFVVWNPHEFARDLL
6 AGSCPAYADLMEENERLRRENARLTRELAHMKKLCNNIIYFMSNYVDPQQPDAAKAM
7 SGPAPFLTKTYQMVCDPATDHVISWGPCG
8 YFGYEEEIERLKRDK
9 AEINDDFWEQFLTEGPGCCE
10 EMRKELIDAISKKRRRPIDDC
11 SFVVWDPHAFSQTLL
12 YFKHNNFS
13 DNMDVLTEQMGYLSS
14 FLNQLVQQQRRSNWWNDDGNRKRRFQALEHGPVDDQETSGGGAQIIQYCPPVPETSNQPIPANEAFCSTPAQPVSSPALEMPMDV
15 DEDKCVKLFGVSIGDKRMRDH
16 QPWPIYRPRPVYHPIRPCNG
17 PQYQQQSVGSCVEVG
18 GGGGGGGG
19 AAAAAA
20 PMEGLHEVGPP
21 ASLDGQIVKYQPMINEAAK
22 TSFYDDHSSTSKQEMGNLLNQHFSDKLKLGLCPAMTESNIITLSTQSSHEDNGSPHGKHPDCDMMGMECLPLVPQMMELSDTGTSICPSKSVCFTPPINDDGFLPCHLNLTLASCPMDVDKSQIPDANGNTID
23 RCEEAAASERPIKMIRIGEPWIGVPSSGP
24 YDHPWLEQDCQMEAQQNCKNPQYADVIT
25 ELENLALNIQGLGKGKID
26 PEADDMGTGSSLEQGSPVLFEPQDPVEFLIDGIPSDLESSAVDAHGLIAPQDI
27 MDADDDERIWGVDASAALQSSCSGTSQQAYGSHVSDPYLMDIANKPEKFWELDFQALDDGDLQLDKCVIDDPALQQQ
28 MASNNVGTFDSTGNDFTDTSALCEWDDMDIFGGELEHILQQPEQDFQVDP
29 SPTYSGEEQVISSNS
30 AMLRKILKLDSSHRFESMGNSDN
  1. Numbers correspond to the motifs described in Figure 4.