Skip to main content

Table 1 Taxa-counting example of Rios Mesquites metagenomic short reads carrying a common SP.

From: Peptide markers of aminoacyl tRNA synthetases facilitate taxa counting in metagenomic data

Index Short read (translated to amino-acid string)  
1 ILTSSSPEGARDFLVPSRLNPGKFYALPQAPQQFKQLI  
2 VFFSFLLGFTKGKFYALPQAPQTILSNLFMVSGFDKYFTNC X
3 PSRLNPGKFYALPQAPQQFKQLIMVSGFDRYFQIAPCFR  
4 DFLVPSRLHKGKFYALPQAPQQFKQLVMVSGFDKYFQI X
5 RFFSSFLGLHKGKFYALPQAPQQFKLTCHGIRVILSN X
6 GARDFLVPSRLNPGKFYALPQAPQQFKQLIMVSGFD  
7 ARDFLVPSRLNPGKFYALPQAPQQFKQLVMVSGFDRYFQI X
8 DFLVPSRLNPGKFYALPQAPQQFKQLIMVSGFDKYFQIA  
9 DFLVPSRLHKGKFYALPQAPQQFKQLVMVSGFDKYFQL X
10 SRLNPGKFYALPQAPQQFKQLIMVSGFDRYFQIAPCF  
11 YFLVPSRLHKGKFYALPQAPQQFKLTCHGIRVILSNC X
12 QAGCGLYCSKQIKSWKFYALPQAPQQFKQLIMI X
13 LNPGKFYALPQAPQQFKQLIMVSGFDRYFQIAPCFR  
14 SFKSRKFYALPQAPQQFKQLIMVSGFDRYFQIAPCFG X
3 = 3U10U13 PSRLNPGKFYALPQAPQQFKQLIMVSGFDRYFQIAPCFR X
1U6U8 ILTSSSPEGARDFLVPSRLNPGKFYALPQAPQQFKQLIMVSGFDKYFQIA X
  1. The first 14 rows display the short reads. The two last rows are fused strings of short reads used for solving the minimal chromatic number problem. Entries in the last column indicate 10 independent sequences (inconsistent with each other).