Skip to main content

Table 3 Sequences and lengths of conserved motifs in the amino acid sequences of Arabidopsis PP2C genes

From: Genome-wide and expression analysis of protein phosphatase 2C in rice and Arabidopsis

Motif Width Multilevel consensus sequence
1 21 DEFLILASDGLWDVMSNQEAV
2 21 WRVKGQLAMSRAFGDWYLKQY
3 15 LYVANVGDSRAVLCR
4 15 HFFGVYDGHGGPHAA
5 57 DIVHNHPRNGIAQRLIKAALQEAAKKREMRYHDLKKIPQGVRRHYHDDITVIVIFLD
6 21 DHKPNRPDERERIEKCGGYVF
7 21 LTEEALQRGSKDNITCIVVCF
8 11 GSTCVTAIICG
9 41 GRQDGLLWYKDLGQHAAGEFSMAVVQANNLLEDQCQVESGP
10 41 YCKKHLFENILKHPDFWTDTKNAIKNAYKQTDQYFLESCSW
11 29 AEQLSTEHNTNIEEVRQELKSLHPDDPQI