Skip to main content

Table 2 Conserved motif analysis of 273 R2R3-BrMYB proteins

From: Genome-wide analysis of the R2R3-MYB transcription factor genes in Chinese cabbage (Brassica rapa ssp. pekinensis) reveals their stress and hormone responsive patterns

Clade Motif Width E-value Multilevel consensus sequence
1 1 21 1.30E-71 EDP[PA]T[SY]LSLSL[PS][WGL][ANP][ND]ES[EV][TS][ES]N
  2 33 2.00E-212 GEFMTVVQEMI[KR][TA]EVRSYMA[ED][LM]QR[GN][NS][GV]GGG[GV][GS]G
2 3 41 4.50E-88 [MPV][HV]PCE[GQ][PN][LK][FIV]Q[AS][ACS][KR][PQ]D[SA][LA][AM][GL][KR][FL]L[QE][SG][LA][CY][SY]E[PR][FN][VI]P
[SQ]KCGHGC[CS][SNT]
  4 14 4.00E-36 S[VL]LGPEFVDY[EL][ED]P[PS]
  5 31 3.70E-57 [SDN][QY]EL[AI][SA]IAT[DE][LI][NS][NS][IL]AW[IL][RK]SGL[ED][NS][SA]SVRE[AM]E[QDE]
3 6 34 4.40E-34 [RG][KN]R[VFP][RM]EPET[ADT]F[PL][CDFY][TP]GG[YS][AT][MAT][ND]EQ[SN][PAG][QRT]L[WL][NC][YNS]P[FY]VE[SN]
5 7 21 1.70E-182 W[TS]RE[ED][ND][KI]AFE[NR]ALA[IV][YF][DP][DE][DE][ST][PE]
6 8 110 6.40E-149 ADVEA[QH]LR[KR]QDVARNKIA[EQ]R[RQ]DAPAAILQANK[LM]NDPE[AV]VRKRSKLMLPPPQISDHELEEIAKMGYASDLL
AENEEL[TM]EGSAATRALLANYSQTPRQGMTP[ML]RTPQRTPAGKGDAIMMEAENLARLRDSQTPLLGG[DE]NPELHPSDFTG
VTPRKKEIQTPNPMLTPSMTP
7 9 80 6.30E-67 GGA[GS]LTPR[IL]GLTPSR[DE]GSSF[AS][MV]TP[RK]GTPFRDELHINEDMDMHE[SN]AKLERQRREEAR[RM]SLRSGLTGLP[Q
L]P[RK]NEYQIVAQ[PA]P
8 10 101 4.60E-96 SVF[ML]SEL[VM]ECCRE[LV]EEGHRAWA[ED]HKKEAAWRLRRLELQLESEKT[SC]RQREK[MT]EEIE[AT]KMKALREEQK[M
N]AMEKIEGEYREQLVGLRRDAEAK[DE]QKLADQW[TS]S[KR]HIRLTKFLEQ[HQ]MGCR
9 11 72 9.30E-166 [NG][EQH][EG][VM]FLKKDD[PS]K[VA]T[ACN]LMQQAELLSSLA[QH]KVN[AS][DE]NT[ED]QSMENAWKVLQDF[LF]NK[SG]
KEND[LI][FL]RYG[ILF]P[DE][IM]DF[QK][LI][ED]E
  12 37 3.30E-66 F[KR]DL[VI][EDG]DLRS[SGT][NY]E[DA][SN][QD][ALPSV]S[WLY]RQPDLHDSPASS[ED][YN]SSGS
  13 20 3.60E-15 T[ITV][MI][PLTV][HD][PQS]SGD[KQ]TQ[QP][FLPQS][MLPS][SAMP][DGS][STP][QDP][TQ]
  14 33 5.70E-66 F[NS]SP[VI]QVTPLFRSLA[AD]GIPSPQFSES[EV][RS][SIN][FH][LV][LT][KN]
  15 21 1.40E-31 PCPSAN[PL]S[QK]PPPCKRVLL[DH]SL
10 16 16 1.20E-102 [CK][RS][SAP][NK][APY][PK]R[PN][SN][IL]L[QE][DN]YI[RK]S[IVL]TN[NG]N[EL]SxS[ST]V[EP]
14 17 29 2.50E-58 ATSS[CS][VAI]T[TS]SN[DNS][QP][FA][MEL][TI][YT][SD][YD][NDV]N[GN]N[VMN][GNV][NQ][GNQ][FT]G[VY]
15 18 33 2.30E-55 RA[EH][EQ]ES[DE]EDEV[KD]KWFKHLESELGLEE[DN]D[NS]QQ[QH]Q
16 19 39 4.80E-22 MES[DG]KE[TA][NC]G[GV][IV][CFG][EG][RT]E[SR]FGVM[KN]SPYENRI[SI]DWIS[EK][IS][SD][TA][DN][QI]
17 20 21 4.10E-34 [DN][GN][SM][SD][SC]S[ST][ST][FM][MS][PQ]DL[TM][TK]V[PS][HQ]F[MI]D
  21 21 1.50E-93 [AY][YE]EDVTQDPMWN[MV]DDIWQF[RE]E
18 22 51 2.60E-50 [HS][HQ]SSEIND[QH][AV]ASTS[ANS]HNVFC[TA]QDQAM[ED]TYSPT[TP]TSYQHTNM[ED]FNYGN[YF]SA[AP]
20 23 29 2.00E-94 D[GD]YYSMDDIWREID[QH]S[GA][AV]NIIKPVKDIYY
  24 28 2.70E-70 [FY]P[PN]LASP[TA]WESSL[ED]SIWNMDAD[EK]SK[MI]SS
21 25 27 1.30E-66 V[PA][VA][TP][SI][SP][DE][AH][NS][MV][NI][ED][ED][GN][AN][IL]W[DG][GS]LW[NS]LD[DL][ED][DG]
24 26 15 1.10E-43 WV[HL][DE]D[DE]FELS[ST]LT[MN]M
26 27 40 1.40E-35 [IP][TQ][TN]NN[PL]F[PT][TA][PG][HN]M[IF]SH[PS][CF][NI][DE]DFTP[YC]VDG[LI]YGVN[TA]G[LV]QGELY
  28 29 7.40E-22 PPLEC[EQ]EGDWY[KN]A[DEN]IN[NS]H[LV][DA][ED][LMV][NK]TNG[AS]GN
  29 24 2.90E-24 [VM]EE[CFY]WDLDQLM[NS]TEVPSF[YH]FNF[KN][QF]
27 30 41 6.80E-27 [TH][SH][HT][KH][DP]N[KD][LV][KQ][SW]PS[LQ][PT][DT][LI]P[AS][QS]T[IV][IS]P[IF][NQ]ET[LM][SQ][DS][LY][DL]DG[E
N][KN][LM][NI][VP]F[VW]
32 31 16 7.10E-50 [MT]F[LM]DY[CN][QL][DE][FY]GV[HE]D[FV][GP]F
33 32 81 7.80E-71 [ED]WF[LI]P[PA]SEN[TI]N[AGV]I[AP]C[AST]TSNNLN[LV][EQ][AV]LD[PL]CF[NS]SK[NT][ML]CHSESFKVGN[IMV][FLM]G
[MI]EN[AGS]SWE[IT]ENPKIGDWDLD[GS]LIDNNSSFPFLDFQV
34 33 21 1.30E-20 EDFGFCYDDKFSSFLN[SA][LV]IND
35 34 21 4.20E-26 [PR][PL][PQ][AEPT]KRR[LP]GRTSRS[AT]MKPK[TFI][HI]
  35 21 4.70E-27 [HQ][QKV][NV][NI][DEN][AT][FLMS][TA]D[ED]F[IV]DWD[CF]VW[QR][EQ]G
  36 48 7.20E-30 [DH]EKE[AGN][SP]D[SP][MV]VSWLL[DN]G[DE]DEATIG[KNQ]SNCE[NK][FS]GEPLDHD[ED]E[NS]ALVAWLLS
36 37 29 2.90E-197 [TR][TN][QH][EY][TP][ST][GTS][TV]YASS[TA][ED]NI[AS][KR]LL[QK][GND][WF][MTV][KS][DS][ST][PS][KS]
37 38 18 1.70E-23 [PT][GNP][LFNS][DEN][DEV][YF][ND]EW[LF][NSI][FY][FILM]DNQ[TA][YCFL]
38 39 32 1.40E-93 [KD][DQ][DS][CAM][MFT]S[FY]E[DN][FIV][GSL]A[DL][IV]D[ED]SFW[SN][ED][VAT][VL][SY][SVM][DQ][DNC]
  40 36 1.00E-96 [EG][ILM][KLQ][QD][ER][NF][QSW][KEQ][LR][GS][SL][YDV][NGS]N[ES][KM][LGIV][YF][ND][DSH][DE]M[ED]FW[FY]DV
[LF][TAL][RS][ST][GRS][GR][EI][QEI]
40 41 29 8.40E-70 [DA][AL][TE][STD][LV][AL]K[AL]QL[LI]H[KNS]M[IL]Q[VI][LI][SNT][PTN][NK][NA][NIT][PNST][NST][ISP][SN][SD][FSI]
41 42 29 5.80E-58 Q[EDT][QS][TAQ][IFL][LS][KNS]LQ[TG]E[MA]A[KQ]L[QA]L[FL]QYLLQ[PM][PS][SNP][MS]S[NAM]
  43 24 4.30E-54 A[ST]SS[SH][SG][QY][EG][SV][GA][AE][ST]AS[AV][ADY]WPDH[LC][LF]D[DE]
42 44 32 4.40E-200 [QL][SA][KP][NA][AS][AP]T[LT][SR]HMAQWESARLEAEARL[AS]RES[KM]L[LF]
  45 20 1.50E-79 [QD][QL][QL]L[ED][SF]P[TI]S[TD][VD][DST][FM]S[EF][LMN][EKL]ENI
43 46 41 1.40E-124 [TP][ST][SP][ST][ST][STE][TS][SH][SF]S[SF]S[SP][TS][GS]S[AV][RC]LLNKLA[AT]GISSR[KQ]H[DAG]LDRIK[NT][VI][IL]
44 47 8 6.40E-100 M[VS]R[TK]PCC[KV]
  1. Significant motifs (e-value < e-100) of more than 10 amino acid length were predicted by MEME analysis. Motif ID, consensus sequences, width (amino acids), and number of R2R3-BrMYB proteins containing the motif and e-value of each predicted motif is given.