Skip to main content

Table 4 Ovodefensin peptides predicted in the Komodo dragon genome

From: The Komodo dragon (Varanus komodoensis) genome and identification of innate immunity genes and clusters

Name Closest Anole Ortholog Closest Snake Ortholog Sequences
Scaffold 210 Ovodefensins This scaffold contains the cluster of six β-ovodefensin genes, one intercluster β defensin, and 15 β-defensin genes that are similar to anole lizard β-defensins. The cluster begins with the CTSB gene. These genes include large β defensins.
VkOVOD1_VARKO LzOVOD1   GM*PPHLCFLAMTLHLACSFCGMNFCAGAPRKLWCYCAAQRCCAL
VkOVOD2_VARKO   SnOVOD1 GRRRASDTQSCIRREGYCKPQCNETGPVPELNLGTCTNRQQKCCRPQEL
VkOVOD3_VARKO   SnOVOD2 GCKGHRSCSSLGGRCAKSCKSLGSGYTAYHTCDCARSGLQCCVPHKKG
VkOVOD4_VARKO LzOVOD14 SnOVOD3 GYRQHCSSYCHGFCSSKCPQHKVAQANCACALYGGICCVS
VkOVOD5_VARKO    GLRDWGSEALLCSGSAPISTADFRRWCWGTLALCHGSYAMEYRRGPFCPPCCL
VkOVOD6_VARKO   SnOVOD5 RHCNTYCYGQCLKSCPYGWVPTSNCACQHTSNICCLPP
  1. Reptile ovodefensin orthologs are also indicated (where they exist) as well as the ovodefensin peptide sequences encoded by each gene