Skip to main content

Table 6 Predicted cathelicidin antimicrobial peptide gene sequences

From: The Komodo dragon (Varanus komodoensis) genome and identification of innate immunity genes and clusters

Cathelicidin Gene Predicted Sequence of Precursor Protein
Cathelicidin2_VARKO MELFLLGVTLLMLGVPGATSPPLDAPSALLPRDVARMAVEDFNQEAEGQAVFRLLKLKHTHKVKFRWGFHFSLNFTIKETHCRKSDNYRIENCRYKTKGPIQDCSAQVSVLNFMPDSPLTSVKCRRGNGRGSRKAQPSAMLQAEERQPQVHVEVYLPSAYSIAALSVAEEEPSRPAARPH
Cathelicidin4.1_VARKO MASPWALPLMLLLLGMVGAAPSTAPPSSYDQVIAAAVDIYNQQQKPEYAFRLLEAEPQPDWNSSAQTNQVLRFSIKETVCRPSEKADLSQCDYKPDGVDRDCSGFYSPQQSPPTIMVQCEDVDQELDRVTRFRWRRFFRKAKRFLKRHGVSIAIGTVRLLRRFG
Cathelicidin4.2_VARKO MASPRALLLMLLLLRTVGAAPSAAPPSSYEQVIAAAVDTYNQQQKPAYAFRLLEAEPQPDWNPSAGTTQPLRFSIKETVCRPSEKADLSQCDYKPNGVDRDCSGFYSPQQQSPPTILVQCEDLDRVTRRRWRRFFQKAKRFVKRHGVSIAVGAYRIIG
  1. Full predicted animo acid sequence of Komodo cathelicidin proteins. Note, the Cathelicidin2_VARKO lacks the VTR sequence that is typically present in other reptile cathleicidin precursor proteins, including Cathelicidin4.1_VARKO and Cathelicidin4.2_VARKO