Skip to main content

Table 8 Comparison to other cathelicidins

From: The Komodo dragon (Varanus komodoensis) genome and identification of innate immunity genes and clusters

Name Species Sequence Length VK-CATH4.1/ VK-CATH4.2 Similarity (%)
VK-CATH4.1 V. komodoensis ----FRWRRFFRKAKRFLKRHGVSIAIGTVRLLRRFG- 33 100/70.00
VK-CATH4.2 V. komodoensis ----RRWRRFFQKAKRFVKRHGVSIAVGAYRIIG---- 30 70.00/100.00
Reptiles (Squamates)
 GJ-CATH G. japonicus -----RWRRFWGKAKRGIKKHGVSIALAALRLRG---- 29 62.07/65.52
 AC-CATH A. carolinensis -----RWGRFWRGAKRFVKKHGVSIALAGLR------- 26 65.38/65.38
 PB-CATH P. bivitatis -----RWRRFIRGAGRFARRYGWRIALG---------- 23 60.87/56.52
 NA-CATH N. atra ----KRFKKFFKKLKNSVKKRAKKFFKKPKVIGVTFPF 34 21.21/26.67
Other Vertebrates
 AM-CATH A. mississippiensis -KIKKGFKKIFKRLPP--IGVGVSIPLAGKR------- 28 24.00/24.00
 CAP18 O. cuniculus -GLRKRLRKFRNKIKEKLKKIGQKIQGFVPKLAPRTDY 37 33.33/26.67
 SMAP-29 O. aries ----RGLRRLGRKIAHGVKKYGPTVL-RIIRIAG---- 29 24.14/34.48
 cc-CATH C. coturnix LVQRGRFGRFLKKVRRFIPKVIIAAQIG-----SRFG 32 39.29/28.00
 CMAP27 G. gallus -----RFGRFLRKIRRFRPKVTITIQGS-----ARFG- 27 40.74/29.17
 Lactoferritin B. taurus -FKCRRWQWR-------MKKLGAPSITCV---RRAF-- 25 27.27/25.00
  1. Homology and alignment of proposed Komodo dragon cathelicidin peptides with known peptides in the Antimicrobial Peptide Database APD3 [64]. These sequence alignments and sequence similarities were generated using Clustal ω [68]