Skip to main content

Table 2 Multiple Em for Motif Elucidation (MEME) protein motifs identified in grape mTERF proteins

From: Identification, characterization and functional analysis of grape (Vitis vinifera L.) mitochondrial transcription termination factor (mTERF) genes in responding to biotic stress and exogenous phytohormone

Motif No. Width Sequence
1 27 ELVRFPQYLSYSLEKRIKPRHSVVKV
2 30 KIVTKYPEJLGASVEKTLKPKLEYLKSLG
3 51 HSFTVSYLMNSCGLSPETAISASKKIQFENPENPDSVLALLRNHGCTDTH
4 24 ESTWZQKMEVYRRWGFSEDEI
5 51 SDSDVAKIJKKRPRILKYDLEKNJKPNIEFLKEJGIPDSSIAKVIARYPR
6 38 AFLKLTEKKFLDRFVIKYZEDVPQLLNLYKGEVGIQE
7 26 AFRKSPLCMQLSEKKIMSTMDFLVN
8 30 DIARILSKYPQILGRSJENNLKPSVNYLV
9 30 ENVKKVMEMGFBPLKLTFVYAJQVISQMS
10 31 EENJLPNJAYLEEJGVPRSQISKLLTRYP
11 42 KYGLSEEEVSEMFKKAPQVLQYSEDKIEEKIDYLVNKMGYP
12 16 CMSLSEKKIMSTMDF
13 21 MTQLHFLGNITPFVIRCF
14 51 HCTRSFQFMDAENMSKNSPFFLZKJLGKVENEQEIGKSJSKFLRYNPINE
15 41 KKDLKLGHFLNLPEGDFLDKYVIKNQDEIPQLLDLYQGKV