Skip to main content

Table 2 List of the identified motifs in TaSCPL proteins

From: Genome-wide analysis of the serine carboxypeptidase-like protein family in Triticum aestivum reveals TaSCPL184-6D is involved in abiotic stress response

MOTIF ID WIDTH
1 PZYKGRPFYIAGESYAGHYVP 21
2 SWNKVANVJFLDSPAGVGFSY 21
3 LTFATVRGAGHTVPEYQPERA 21
4 YSGDHDSVVPVTGTRAWIRSLGLPV 25
5 KPLVLWLNGGPGCSS 15
6 GVPFDQYTGYVTVDEENGRALFYYFVEAE 29
7 WGHGIISDZLYEAITKNCDFD 21
8 VGDNRTALDAYVFLVKWFERF 21
9 GPLINLKGYLVGNPLTD 17
10 CRTYGYYLSYFWANBNMTRDALGIKKGTVGEWVR 34
11 YLNRPDVQKALHANTTGW 18
12 CNKDLPYTHDIPSSIKYHRNLTTRGYRAL 29
13 NWKDSPASMLPTJKWLIEAGJRVWV 25
14 MEELGPFRVNPDGKT 15
15 GVALGDSWISPEDFALSYAPLLYQVSRLDDNALDAANKLAATVKEQJAAGQFAAAEKSWTDLLDFIDQQSNSVDMYNFLL 80
16 WRPWHLDGQVA 11
17 AVADQSGAKEADRITALPGQP 21
18 AVADQSGAKEADRITALPGQP 15
19 LKIIPKBVTWEECSDAVYEALVNDFMKPRIPEVDELLRYGV 41
20 LVLFSSFLKGKLPPY 15