Skip to main content

Table 2 Motif sequences of JrPP2C proteins identified by MEME tool

From: Transcriptome-wide identification of walnut PP2C family genes in response to external stimulus

Motif Width Best possible match
Motif1 29 LTPDDEFLILASDGLWDVLSNZEAVDJVR
Motif2 15 LVVANVGDSRAVLCR
Motif3 15 AFFGVFDGHGGPDAA
Motif4 21 LAVSRAFGDWYLKKPVVSEPP
Motif5 21 LVEEALRRGSKDBITVIVVDL
Motif6 21 DHKPERSDERERIEAAGGRVS
Motif7 37 YLKEHLFENJLKDPDFWTDTEKAIRSAYRQTDAAFLK
Motif8 19 PDLASSGSTAVTAJIVGGT
Motif9 26 VRSGSASDIGRREYMEDEHIIIPDLL
Motif10 32 ITHGFHLVKGKSNHPMEDYVVAEFKQFKGHE
Motif11 29 PEGDPARHLVEELLFRAAKKRGMDYHELL
Motif12 36 GRIFLNGASKIASJFTQQGKKGTNQDAMIVWENFGS