Skip to main content

Advertisement

Table 1 NB-LRR-specific amino acid motifs identified with psp-gen MEME [56].

From: Identification and localisation of the NB-LRR gene family within the potato genome

Motifa Sequenceb Domain Group similar to Reference
motif 1 PIWGMGGVGKTTLARAVYNDP NB-ARC CNL/TNL P-loop [6]
motif 2 LKPCFLYCAIFPEDYMIDKNKLIWLWMAE NB-ARC CNL RNBS-D [6]
motif 3 CGGLPLAIKVWGGMLAGKQKT NB-ARC CNL/TNL GLPL [6]
motif 4 YLVVLDDVWDTDQWD NB-ARC CNL/TNL Kin-2 [6, 15, 16]
motif 5 NGSRIIITTRNKHVANYMCT NB-ARC CNL/TNL RNBS-B [6]
motif 6 HFDCRAWVCVSQQYDMKKVLRDIIQQVGG NB-ARC CNL RNBS-A [6]
motif 7 CRMHDMMHDMCWYKAREQNFV linker CNL/TNL MHDV [6]
motif 8 MEDVGEYYFNELINRSMFQPI linker CNL/TNL -  
motif 9 LIHLRYLNLSGTNIKQLPASI LRR1 CNL/TNL Motif1 LDL [6]
motif 10 LSHEESWQLFHQHAF NB-ARC CNL/TNL RNBS-C [6]
motif 11 MPNLETLDIHNCPNLEEIP LRR CNL/TNL -  
motif 12 IMPVLRLSYHHLPYH NB-ARC CNL/TNL -  
motif 13 QIVIPIFYDVDPSDVRHQTGSFGEAFWKHCSR TIR TNL TIR-3 [6]
motif 14 AIKDIQEQLQKVADRRDRNKVFVPHPTRPIAIDPCLRALYAEATELVGIY monocot - -  
motif 15 KNYATSRWCLNELVKIMECKE TIR TNL TIR-2 [6]
motif 16 DAAYDAEDVIDSFKYHA pre-NB CNL EDVID [24]
motif 17 FAIPKLGDFLTQEYYLHKGIKKEIEWLKRELEFMQA pre-NB CNL -  
motif 18 KYDVFLSFRGADTRRTFTSHLYEALKNRGINTF TIR TNL TIR-1 [6]
motif 19 IKMVEITGYRGTRFPNWMGHPVYCNMVSISIRNCKNCSCLP LRR CNL/TNL -  
motif 20 ETSSFELMDLLGERWVPPVHLREFKSFMPSQLSALRGWIQRDPSHLSNLS monocot - -  
  1. aMotifs are listed according to their ranking derived from the psp-gen MEME analysis. bConsensus amino acid sequence derived from psp-gen MEME analysis. References for known motifs encompassed in the MEME motifs are shown.