Skip to main content

Table 1 Human specific alternative FAK transcripts (1)

From: Organization and post-transcriptional processing of focal adhesion kinase gene

mRNA sequence reference mRNA feature Other sequence containing this modification Found by RT-PCR in brain (2) Predicted amino acid modification
  Deletion Insertion/replacement    Deletion (3) insertion/replacement
NM_005607 (stomach) - exon -3bH: 77 nt upstream from exon 1 - No - MISADCNLCLPEYDRYLASSKI (alternative ATG in exon -3bH)
- exon 2 - human : CB990597 (placenta), CF138217 (lymph), BU838559 (DRG) Yes 66–121 (exon 2) and 123–1096 STOP codon in exon 3
BC028733 (hippocampus) exon 1–14 135 nt upstream from exon 15 human : BC043202 (hypothalamus) macaque : CJ459742, CJ459819, CJ460273 (medulla oblongata), CJ445344 (brain) Yes 1–392 MKYQEVRCLTSFNISVSFPA (Alternative ATG in intron 14)
L05186 and see ref 43 - exon 18a: 85 nt between exons 18–19 - Yes 519–1096 ACHYTSLHWNWCRYISDPNVDAAQTPGMQSNNASV*. change in ORF, (*) STOP codon in exon 19
  exon 22–34 15 nt downstream from exon 21 - Yes 579–1096 GKKSE* (*) STOP codon in intron 21
  exon 24–34 exon 23a : 91 nt between exons 23–24 - Yes 677–1096 FQNPAQMLPASGRLPNQPCPERENYSFATF* (*) STOP codon in exon 23a
  exon 28 - human : BQ428019 (melanotic melanoma) dog :XM_851079.1 Yes 834–854 no change in ORF
BC035404 (placenta) exon 26 - - No 744–789 no change in ORF
- exon 29 - - Yes 896–908 (exon 29) and 972–1096 change in ORF in exon 30 and STOP codon in exon 32
  1. (1) See also Fig. 2 or 3.
  2. (2) Experimental results obtained in the present study (see Results for details).
  3. (3) Present nomenclature, see additional file 5