Table 1 Human specific alternative FAK transcripts (1)
From: Organization and post-transcriptional processing of focal adhesion kinase gene
mRNA sequence reference | mRNA feature | Other sequence containing this modification | Found by RT-PCR in brain (2) | Predicted amino acid modification | ||
|---|---|---|---|---|---|---|
| Â | Deletion | Insertion/replacement | Â | Â | Deletion (3) | insertion/replacement |
NM_005607 (stomach) | - | exon -3bH: 77 nt upstream from exon 1 | - | No | - | MISADCNLCLPEYDRYLASSKI (alternative ATG in exon -3bH) |
- | exon 2 | - | human : CB990597 (placenta), CF138217 (lymph), BU838559 (DRG) | Yes | 66–121 (exon 2) and 123–1096 | STOP codon in exon 3 |
BC028733 (hippocampus) | exon 1–14 | 135 nt upstream from exon 15 | human : BC043202 (hypothalamus) macaque : CJ459742, CJ459819, CJ460273 (medulla oblongata), CJ445344 (brain) | Yes | 1–392 | MKYQEVRCLTSFNISVSFPA (Alternative ATG in intron 14) |
L05186 and see ref 43 | - | exon 18a: 85 nt between exons 18–19 | - | Yes | 519–1096 | ACHYTSLHWNWCRYISDPNVDAAQTPGMQSNNASV*. change in ORF, (*) STOP codon in exon 19 |
|  | exon 22–34 | 15 nt downstream from exon 21 | - | Yes | 579–1096 | GKKSE* (*) STOP codon in intron 21 |
|  | exon 24–34 | exon 23a : 91 nt between exons 23–24 | - | Yes | 677–1096 | FQNPAQMLPASGRLPNQPCPERENYSFATF* (*) STOP codon in exon 23a |
|  | exon 28 | - | human : BQ428019 (melanotic melanoma) dog :XM_851079.1 | Yes | 834–854 | no change in ORF |
BC035404 (placenta) | exon 26 | - | - | No | 744–789 | no change in ORF |
- | exon 29 | - | - | Yes | 896–908 (exon 29) and 972–1096 | change in ORF in exon 30 and STOP codon in exon 32 |