Skip to main content

Table 2 List of the putative motifs of StHsp20 proteins

From: Genome-wide analysis of the potato Hsp20 gene family: identification, genomic organization and expression profiles in response to heat stress

Motif Width Best possible match
1 113 FPPSSSRETSAFANTRIDWKETPEAHVFKVDVPGLKKEEVKVEVEEDRVLQISGERSREKEEKNDKWHRVERSSGKFMRRFRLPENAKMDQIKASMENGVLTVTVPKEEEKKP
2 20 DVDKIKAKMENGVLTVTVPK
3 19 ADLPGLKKEDVKVQVEDNG
4 15 SNIFDPFSLDVFDPF
5 11 MSLIPRFFGGR
6 45 TDDATIGTASVLAAKLKMPRKVMNMTLVALLVLGIGLVVSNKMKS
7 15 RSYGKFSTSFNLPEN
8 21 VYEDFVPSTELVQEEDSDTLL
9 8 VKSIDISG
10 41 PSHEFYLETPRSLIAPSLSFPHVPQYMAQIEYKETPEAHIF