Skip to main content

Advertisement

Table 5 Motif sequences for HMAs identified by MEME analysis

From: The genome-wide impact of cadmium on microRNA and mRNA expression in contrasting Cd responsive wheat genotypes

MotifWidthMultilevel consensus sequence
150LNLBGYJHVRATKVGSNSALAKIVRLVEEAQMSKAPVQRLADKVAKYFVP
241TPTAVMVATGVGARRGVLIKGGDVLESLANIKAIAFDKTGT
350VGDVIKVLPGEKVPVDGVVVDGRSHVBESMLTGESAPVAKZVGSEVIGGT
450AIGSGTAVAIEAADVVLMSNBLEDVPTAIDLSRKTFRTIRQNYVWAVAYN
541KFFEESGMJVFFFLLGKYLEVLAKGKASDAMSKLMELAPET
629ELQKRGGPVAMVGDGINDAPALAAADVGM
750IVGIPVAAGALFPFTGFRLPPWLAGACMAFSSVSVVCSSLLLRLYKKPRH
826SMGIKSVMLTGDNWAAAQAVAKZVGI
929ELLYLVASAESNSEHPLAKAIVEYAQSFS
1029EEVADFEILPGEGVYAEIDGKKVLVGNKR
  1. Motif numbers corresponded to the motifs in Additional file 2: Figure S8