Skip to main content

Table 2 Identified Komodo dragon Defensin genes grouped based on scaffold locations of gene clusters

From: The Komodo dragon (Varanus komodoensis) genome and identification of innate immunity genes and clusters

Name Closest Anole Ortholog Closest Snake Ortholog Paralogs Sequences
Scaffold 210 This scaffold contains the cluster of six β-ovodefensin genes, one intercluster β defensin, and 15 β-defensin genes that are similar to anole lizard β-defensins. The cluster begins with the CTSB gene. These genes include large β defensins.
VkBDic1_VARCO LzBD81 SnBDic1,2   GLAKRKPRSRRECYSLDGSCYLGRCPSVLKKYGWCGTLKRCCIR
VkBD1_VARKO LzBD1 SnBD1,   AMGDLYDSLECHNHHGHCRRICFHNERSIGTCTNRRQLCCK
VkBD2_VARKO LzBD2 SnBD2, VkBD3,4,5,6 GKGDFVTLGCLFRGGACKTDTCRDNEVQIGNCSNTKQLCCKKTR
VkBD3_VARKO LzBD3   VkBD2,4,5,6 GALQDKKGSCDLALHNCRMGFCSQEEIPTGEFCFEPVILCCKHLPEKSKSPERLEGVASFADVLRNLL
VkBD4_VARKO LzBD4 SnBD3, VkBD2,3,5,6 GGGQREARFVSHCLRRGGICRYDDCSEGEEQIGTCYHHTMICCRDEVM
VkBD5_VARKO LzBD4 SnBD3,4, VkBD2,3,4,6 GASLNLSARICWQRGGRCRSSPCYYDEAQIGTCYHARLKCCRQTE
VkBD6_VARKO LzBD5   VkBD2,3,4,5 GHSNEIDTQQCLKDKGTCHPTICPTQKMSKGTCYSGAQLCCVGESVHMCVRPFFPSCCFSRLSCSRSGGL
VkBD7_VARKO LzBD6,82 SnBD5,6, VkBD8 GQPHICKRMGGYCQITSKPCPYGFLPTTCGIFQTCCAKKPPTTNDCEKLGGFCRVPLHEKCPSGQDLPANCGINARCCKPETA
VkBD8_VARKO LzBD6,82 SnBD5,6, VkBD7 GQVPACTKLGGHCVTPLTVTCPYGSLGANCGINAICCAR
VkBD9_VARKO     TIGTFLVIQAKLCRKAGGFCISRFAHCPSSEIILIRCRSAQKCCKQ
VkBD10_VARKO LzBD11 SnBD7,   EGCPVEAMLLTCTSLGGFCMLEPNQTCPSGLILDVPCHFKRRCCSKKEV
VkBD11_VARKO     GQSLSCRELGGLCVALADDDCDSEEILPADCGRLTLCCKG
VkBD12_VARKO LzBD12–17 SnBD8
(python only)
VkBD13,14 EQALRRVPPVQIRSIRRYCNGRDGYCLDRKFFCESGFVYKEEYNDCMFQNKNKCCVIQKSK
VkBD13_VARKO LzBD12–17 SnBD8 (python only) VkBD12,14 DPSLPSKKAATSRFTTFACNGNFGYCLPRNWRCFSGLVYKEEFNDCPLPDIFKCCL
VkBD14_VARKO LzBD12–17 SnBD8 (python only) VkBD12,13 NKGLPTTTRVGKIPCLGPWGHCFFRKYRCASGFVMKERFNNCPNTRTLKCCVL
VkBD15_VARKO     GFLHVLARHCQKLGGTCKPHKAQCKVRIQILVPCGPGRKCCL
Scaffold 286 We identified 40 β defensins genes, including multiple large defensins (with some peptides containing eight instead of typical six cysteine residues) and peptides with multiple domains.
VkBD16_VARKO    VkBD17, 18 GGGLQDGEDPPGPRASCNSGRGYCLRCGAACPSGQIYVYNDCANPCSNKCCVRR
VkBD17_VARKO    VkBD16,18 GQSSYWGHLSCNSGRGYCLPCHLRCPYGYYYYNDCPGQCRYKCCVRR
VkBD18_VARKO    VkBD16,17 APDRVPHEQAPPCNHGLGYCHPCSLPCTSGKYYYYNDCDKPCANRCCTKQ
VkBD19_VARKO     GTELMEEEYLARAILCHSGQGVCRPRDLQCPSGLTYIYNDCPKTELYKCCAK
VkBD20_VARKO     EQNRLARSKCVCRKFCYPNEYPMGMCAIILVPMCCTFDPQGGS
VkBD21_VARKO    VkBD22 VSDKSSSCRSAGGKCYLILCPRGTGRIGKCSFTHVCCK
VkBD22_VARKO    VkBD21 GRTEVHDVRMCKLYGGECFLLVCPPGRAFIGKCSRLNVCCRG
VkBD23_VARKO LzBD26 SnBD9, 10 (Colubroidea only)   GLAPDTPHDRSSCELNSGFCYSSNCPRCFGQYGFCDDKHPSCCVRDNSIPGCEVVTTPTYDKSSKTTAVPTTSETAPPQTAPPQTAPPQTAPPQTAPDESDKKC
VkBD24_VARKO LzBD27    GYGLVPAGLSDTIKCRTTPRSFCKAVVCPPTFEPTGTCFGGSMHCCSK
VkBD25_VARKO     GEFANISNYYQCRHAGAMCAIFKCPAPFNSIGKCGIFKPCCI
VkBD26_VARKO     GSTEIIGEAKCAEYTGTCRLFECPISSMVENIGYCREDYVCCIR
VkBD27_VARKO LzBD31    DGGTCRQLKGFCSTRRCPDKTFEVLGRCTPRKACCQKKANA
VkBD28_VARKO LzBD32,33 SnBD13,14   GNAQAAEPDTLQCVRAGGSCNFGECRPPSVASGTCKGETLNCCKW
VkBD29_VARKO LzBD34,35, 37,73   VkBD30,31 GHSVSNEAECKREGGFCIIAIGNPCRFPYGFIGKCSWWKFCCK
VkBD30_VARKO LzBD34,35, 37,73   VkBD29,31 GSARWVKNEDECKEDGGTCLAIVIGGCGPLLQIGICGLGRNCCK
VkBD31_VARKO LzBD34,35, 37,73   VkBD29,30 GCSISDRKECREGGGFCLPFLPNMCQVFSIIIGKCSRWSYCCKW
VkBD32_VARKO     ASTINTSQQCKNAGGHCIWSSCGFPLCPVGRCGYWSLCCKA
VkBD33_VARKO     GTPASPVRGPLQCVKQGGFCMSGNCRFPLRKLGTCHRFKACCIR
VkBD34_VARKO LzBD39 SnBD15   GIYTTLDLEMLSCLSAKDAYCKTGHCLEYSVSLGKCNSYLSCCRSMINNLWRCAIAKGYCSMWTCPPPLIKNGRCSRDSPCCVQ
VkBD35_VARKO LzBD41,43 SnBD17 (Colubroidea only) VkBD36 GLAMRTERIDSAEECAKIQGFCTSEPECNTVYPIQGTCGEGTLCCLE
VkBD36_VARKO LzBD41,43 SnBD17 (Colubroidea only) VkBD35 TGYTCVLEEILTKEDCELIGATCIDGEDCNPPFPSQGTCGEGTVCCIP
VkBD37_VARKO LzBD50    GLTTYVTSPEECESIKGFCTPRLCQENFRTLGECSAGIPCCTR
VkBD38_VARKO   SnBD17 (python only)   GFTRDIWDRPTCRSSQGFCWLITCPWPFAKHIGECIWPILRCCA
VkBD39_VARKO LzBD52,53,55 (2 defensin domains)   VkBD43 DLAADCRLREGRCTRTSCSKTDIYLGECAKEIQCCKRDPALHCERQGGLCTQASCTGSDINLGPCGRGLKCCKKDPVAHCEAQGGKCVQNSCPTSDVFLGRCGNGFQCCKT
VkBD40_VARKO LzBD52–55    GQPQKYIEKKECMDFGAQCTKAHCGEDYIFYGFCRTGVACCKR
VkBD41_VARKO LzBD57 SnBD22 (pseudo-gene)   GVALPFQDDSVCIERGGRCMHLPCHPLRRIGRCLLNTYCCH
VkBD42_VARKO LzBD58    GSTQFIKLAHKCLDAGGRCQKQACDFRKSIGRCNDQELCCKR
VkBD43_VARKO LzBD52,53,55 (2 defensin domains)   VkBD39 DPVASCASQGGKCTPDICPSNFVLVGQCDQKLLCCKRDPVAHCKSQGGRCMQSRCASNNEYLGDCGPAVWCCKM
VkBD44_VARKO     GFAHMGINFREQCQWAEGKCQLYHCPAGWKKIGKCSKVVPCCSDK
VkBD45_VARKO     GSNPKQCEQKRAQCMIVCPRTHKKVGHCGRSLSCCAQR
VkBD46_VARKO     GYTSAVARCRRRGGKCHFGRCPQGKNRIGLCFLGTPCCTR
VkBD47_VARKO LzBD63    GFTTEIRRARTCIEANGKCRLATCLHDPWERIGKCGDKRFCCKK
VkBD48_VARKO    VkBD50,52, 53,54 GHTFGFLRCRRNGGHCFPRGCPVGWKPRGRCIGRFTCCVRQGKRPAMEKARQ
VkBD49_VARKO     GHTFGVGECRDQFGSCKFAVCRNGWRRVGWCFLAVPCCRR
VkBD50_VARKO    VkBD48,52, 53,54 GTGQTPGALRCQRNGGLCFPWGCPPGWRPRGRCFGRFTCCIR
VkBD51_VARKO     GRTSGLVACQRKRGICLVGRCRPGWRQVGWCSRGVSCCKW
VkBD52_VARKO    VkBD48,50, 53,54 GQKPVILRCLRNGGRCFSWRCPSGWMLRGPCLRPFICCVR
VkBD53_VARKO    VkBD48,50, 52,54 GRTFGPPRCRRIGGFCIPRRCPSGWRQRGPCLGPFTCCKR
VkBD54_VARKO    VkBD48,50, 52,53 GTARTFGPARCRRIGGLCIPWGCPSGWRRRGRCFGRFTCCKR
VkBD55_VARKO     GGSSDGQPVSAPSSARLMRRCRSFYSPCKTCPVLLKELSCQVVHHPCCPPLKLLHL
Scaffold 7 We identified seven β-defensins on the edge of a large scaffold. This cluster ends with the gene XHO1
VkBD56_VARKO    VkBD58,60 GCLGVYEKGRRQCCTRNGHCYFLFCKKGTVKIGTCNFFSRCCSR
VkBD57_VARKO     GLAGENELDQRGCRRRCLVRHCTRRGRFYVCRRYYICCGR
VkBD58_VARKO    VkBD56,60 ECLGVYVKGRRQCRTQNGHCYFFYCKKDTYKIGICNFFTICCSR
VkBD59_VARKO     VSSPEECGRHGGLRLAGPRFSCWSGLLTGHCDAKHRCCKR
VkBD60_VARKO    VkBD56,58 ECHGMYVNGKRQCHTQNGHCYFLYCKKDTYKIGTCNFFSRCCSR
VkBD61_VARKO LzBD77    GFSWSNDATLRCRYTGGYCDSLICRWPLRNAGFRCKNNRPCCKR
VkBD62_VARKO LzBD78    GSARTPRSDLECQVHKGMCFPHGCPAQWSRIGSCSVRKHRCCR
Scaffold 45 We identified three β-defensin genes and TRAM2 on the edge of a large scaffold. The gene VKBD80 may be a duplication. TRAM2represents the end of this cluster.
VkBD79_VARKO     PGPYPCNWVCHTSPGVQSVCSAMPVRLKLLLGLASVCISVSTLCCFRQH
VkBD80a_VARKO LzBD80 SnBD40,   GRCRRLKGVCRHTLCHPVEVYVGRCNNGMGNCCVDDAEDIRKHIK
VkBD80b_VARKO LzBD80 SnBD40,   GRRRRLKGVCRHTLCHPVEVYVGRCNNGMGNCCVDDAEDIRKHIK
  1. Reptile β-defensin orthologs are also indicated (where they exist) as well as the β-defensin peptide sequences encoded by each gene. Overall, 66 β-defensin genes were identified, of which 4 encode multiple defensin domains (VkBD7, VkBD34, VkBD39, and VkBD43)