Skip to main content

Table 7 Predicted active cathelicidin peptides and calculated properties (APD3 [64])

From: The Komodo dragon (Varanus komodoensis) genome and identification of innate immunity genes and clusters

Peptide Name Predicted Functional Cathelicidin Sequence Length Net Charge MW
VK-CATH2 No C-terminal cathelicidin peptide predicted. NA NA NA
VK-CATH4.1 FRWRRFFRKAKRFLKRHGVSIAIGTVRLLRRFG 33 aa + 12 4133.02
VK-CATH4.2 RRWRRFFQKAKRFVKRHGVSIAVGAYRIIG 30 aa + 10 3660.39