Skip to main content

Table 2 Motif sequences identified by MEME tool

From: Genome-wide identification and transcript profiles of walnut heat stress transcription factor involved in abiotic stress

Motif Number of amino acids Best possible match
Motif1 50 FVVWBPPEFARDLLPKYFKHNNFSSFVRQLNTYGFRKVDPDRWEFANEGF
Motif2 21 PFLTKTYDMVDDPATDSIVSW
Motif3 20 LRGQKHLLKNIHRRKPVHSH
Motif4 29 MEQRQQQMMSFLAKAMQNPGFJAQLVQQQ
Motif5 29 FGLEEEIERLKRDKNVLMQELVKLRQQQZ
Motif6 30 APVPPGINDTFWEQFLTETPGTSDADEISS
Motif7 41 EETILPEFSEJQGIMPESTAEIPDMNYAGSETGNASYVDPM
Motif8 32 PSMNEAAKALLRQILKMBGSPRVEPLMBNPGA
Motif9 29 HGLZQGKKNGWDKIQHMDKLTEQMGLLAS
Motif10 50 PISAELFMPAEPEFPISSPSTANSDIQSSSYAMPDHAIEAQFPNLDVYNS
Motif11 21 NRRITAGNKKRRLPIEEESES
Motif12 11 SSLGACVEVGK
Motif13 15 PPPQPMEGLHETGPP
Motif14 29 JFDDAPSTNAFDSGSSTNRVSGVTLSEVP
Motif15 15 ATDHQLQAMEQRLQG
Motif16 11 NAPDGQIVKYQ
Motif17 15 MADVNDAGSSTTATT
Motif18 50 VNGSLPIEIDYISPDADIDLFLSDPNFWDDLVQSPVPEDIESNSVQGMSK
Motif19 29 KFGSDQEDLIVKQGDCGGSRGGLVEQAGG
Motif20 48 KQQKRELDGEEFVKRRRLLASHGREKAIDKIHRINCRNQVPGGLVTTL